PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04720A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 851aa    MW: 94513.5 Da    PI: 8.4346
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04720AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.1e-154084348
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                WT++Ed +l ++ k  G ++W+++ar+m+ gR++kqc++r++++l
  Oropetium_20150105_04720A 40 EWTADEDAQLERLAKDNGFKHWRRVAREMP-GRSPKQCRDRLRDHL 84
                               7*****************************.************986 PP

2Myb_DNA-binding22.42.9e-0792133346
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                ++T+ +de l +++ ++Gg+ Wk + r +  gRt   ++ rw  
  Oropetium_20150105_04720A  92 PFTAADDEELQRLFLRHGGR-WKEVRRAVH-GRTSRVLRRRWKE 133
                                79******************.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.3473388IPR017930Myb domain
SMARTSM007172.8E-133786IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-1838131IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-154093IPR009057Homeodomain-like
CDDcd001673.31E-124084No hitNo description
PfamPF002493.8E-134084IPR001005SANT/Myb domain
SMARTSM007177.3E-589137IPR001005SANT/Myb domain
PROSITE profilePS512948.63990139IPR017930Myb domain
PfamPF139216.1E-593134No hitNo description
Gene3DG3DSA:1.10.10.603.6E-894134IPR009057Homeodomain-like
SuperFamilySSF507294.81E-6220301IPR011993PH domain-like
Gene3DG3DSA:2.30.29.306.5E-4221303IPR011993PH domain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MTASAPPAAA AAGVRSVLLI KMEPNSFRVR SVLRFRPSPE WTADEDAQLE RLAKDNGFKH  60
WRRVAREMPG RSPKQCRDRL RDHLARDLFH RPFTAADDEE LQRLFLRHGG RWKEVRRAVH  120
GRTSRVLRRR WKEIRNGDAF LTKLWKPTTD AAASSQLPFP PPPPPPALPA WPSNIGFLWI  180
LEPEKIPKPT NERSSIGHPK ETKDKKNIIE VFPARKMAMI KGHSLILSTP DGSQTTIPLL  240
NCTVLAVSAS SMPSRKWAKR YPIKLKSKEY DIYNGSKTCY LYTDTSWEKE SWCKALRIAA  300
TTDKDKLNWH AKLSKEFLNY ISLLNSEYPC FLKPPVLSAE DHEVMDRAVK TDGSSKVRLF  360
LKKLAKKAST KAPLLDSRTS LASSGQGEKK ILDKLRSYQG APFIEALIGP LEDKSGSSSL  420
QDTVKAPGTP ASSSDTLQLP ALPDVNADDR VADEGTLCWN LLSSRLFFDA KMSDGINKAI  480
KARIQKTLSN MRTPAYMGEI TLSDFSIGKL PPYVHAMRVL PLDLNELWAF EVDFEYSEGI  540
LLHIETRLEV QEPELQKDIM KTGFGEESDG DVNSDLLESI EEYGSQFQSS QNTVTSAEKK  600
DEADASSQSK NTGSGWTSTY ISRLKNILHS IADHVSQVPL SLAIRISSVR GVLRIHVKPP  660
PSDQIWYGFT SMPDLEWELE SSIGDRKITN SHIATLIGNR FKASLVETLV LPNCESITVP  720
WMLAEKDDWV PRKDAPFIWL NHEPTEVRSH GTGAATASAH PEEAVLEGDA GNKKAMLRSP  780
DSSKGNEELP KAVASTENAV EKPVAEASRA QPLLASGGES SHSDETKELT KPLLATEKLV  840
QEEGSGSPLP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A7e-1342131695MYB3
3zqc_D7e-1342131695MYB3
3zqc_G7e-1342131695MYB3
3zqc_J7e-1342131695MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954472.10.0PREDICTED: uncharacterized protein LOC101777078
TrEMBLA0A0A9MT980.0A0A0A9MT98_ARUDO; Uncharacterized protein
STRINGSi016325m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-12myb domain protein r1